HORDB

ID: hor000117
Uniprot ID: Q2V2G5
Protein name: Small cardioactive peptide-related peptide
Gene name: SCPRP
Organism: Octopus vulgaris (Common octopus)
Family: SCP family
Source: animal
Expression: Expression is seen in the peripheral and central nervous systems in tissues such as the brain, the inferior buccal ganglion, the gastric ganglion, the olfactory lobe, the peduncle lobe and the optic lobe. Expression in the brain is distributed in the medi
Disease: NA
Comments: NA
Taxonomy: Octopus (genus), Octopodidae (family), Incirrata (suborder), Octopoda (order), Octopodiformes (superorder), Coleoidea (subclass), Cephalopoda (class), Mollusca (phylum), Lophotrochozoa, Spiralia, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
GO MF: NA
GO BP: GO:0007218 neuropeptide signaling pathway
GO CC: GO:0005576 extracellular region

Sequence: SNGYLALPRQ
Length: 10
Propeptide: MFCKHLSFVAITICFLLVLAKTENEIQQKNIKFDQRTWRNMRSNGYLALPRQGRSDNQPDYTCCGMPLTKYVGICPIGMECCPGLKKVLQKSGQRTIYSVCVADAY
Signal peptide: MFCKHLSFVAITICFLLVLA
Modification: T10 Glutamine amide
Glycosylation: NA
Mutagenesis: NA

Function: Be involved in feeding behavior generated by contractions of the muscles of the buccal mass;as a neuromodulator and/or a neurotransmitter in the nervous system concerned with the sensory functions and the movements.
Mechanism: Oct-SCPRP was shown to evoke contractions with increased the tonus in the radula protractor muscle, and oct-SCPRP mRNA was expressed in the superior buccal lobe, which controls the movement of the buccal mass
Cross BBB: NA
Target: NA
Target Unid: NA
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor000117_AF2.pdb

hor000117_ESM.pdb

Mass:	127897	Formula:	C49H79N15O15
Absent amino acids:	CDEFHIKMTVW	Common amino acids:	L
pI:	9.35	Basic residues:	1
Polar residues:	4	Hydrophobic residues:	3
Hydrophobicity:	-62	Boman Index:	-1805
Half-Life:	1.9 hour	Half-Life Yeast:	>20 hour
Half-Life E.Coli:	>10 hour	Aliphatic Index	88
Instability Index:	1646	Extinction Coefficient cystines:	1490
Absorbance 280nm:	165.56

PubMed ID: 16443307
Title: Isolation and Characterization of a Novel Small Cardioactive Peptide-Related Peptide From the Brain of Octopus Vulgaris